PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00002.1_g00078.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 369aa    MW: 41605.1 Da    PI: 9.6321
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00002.1_g00078.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1217e-072372831763
                              HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              A+rsR RK+++i eLe+ v++L+ae ++    l+ l++    l +e+
  Rsa1.0_00002.1_g00078.1 237 AQRSRVRKLQYISELERTVQALQAEGSKVSADLDFLNQRNLILSMEN 283
                              89***********************9999999999988776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.7E-6221296No hitNo description
SMARTSM003380.007224285IPR004827Basic-leucine zipper domain
CDDcd147031.13E-14229276No hitNo description
SuperFamilySSF579592.19E-5237279No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MASSKGTQSV KDLMHPGKNA LLPPKIPFPT VSAPYSEYIP LGSRHGHKLN DEKPHHHHQR  60
TSSESDLVEE PPSWLDDLLN EPESPVRKCG HRRSSSDSYA YLDMANAKNI SLTLQNDFSY  120
RNTGSSPSQR GGVHELDWSR NTQDAAFYSD SNFLNRQRDS LVASGPRPSW LPFTRDSVGG  180
KHMGPSSYMP QEAPEAKNYA KTLSHDPKKF SPELKNSNTQ PGTSDADNTR RAKQQFAQRS  240
RVRKLQYISE LERTVQALQA EGSKVSADLD FLNQRNLILS MENKALKQRL ESIAQEKLIK  300
QLEQELLEKE IGRLRALYQQ QQQQTQQPSA THKRASSKDL DSQFSSLSLN SKDSNSSRDS  360
VSVTSQFHF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013661722.10.0PREDICTED: uncharacterized protein At4g06598
RefseqXP_013661721.10.0PREDICTED: uncharacterized protein At4g06598
TrEMBLA0A078GVJ80.0A0A078GVJ8_BRANA; BnaC09g15590D protein
STRINGBra027885.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-154bZIP family protein